MIXING & BLENDINGNEWSINTERNATIONALFood&DrinkFood&Drinkwww.fdiforum.netOCTOBER 2017£3.50 STERLINGLABELLING &TRACEABILITYCelebrating20 yearsCelebrating20 years01_Layout 1 25/09/2017 14:20 Page 1Companies are constantly looking for ways to increase turnover andmaximise profits by introducing new services to their customers.For Coldstore companies, using industrial microwave technologycan enable them to offer a facility that they can not only store theircustomer’s product, but also, temper and deliver it to them at thecorrect temperature.Industrial microwaves have been used in the food industry for manyyears. They are very simple to use and provide consistent, reliableresults. For example, a 25kg block of frozen meat, at approx. -18°Ccan be tempered up to around -3°C in a matter of minutes.3 & 4 Bankfield Court| Ferryview Business Park| Commercial Road| Bromborough| Merseyside| CH62 3NN| UKTel : +44 (0)845 293 2910| Fax: +44 (0)845 293 2802| Email: uk@selo.com| www.selo.comIMPROVE CUSTOMER SERVICE BY USINGMICROWAVE TECHNOLOGYA variety of other products can be tempered on this system such aspoultry, vegetables, butter and fish.The flexibility of this system means that production schedules caneasily be planned and fulfilled and any late or surprise orders canalso be processed within minutes.Various models in the range allow us to supply a machine to suityour requirements and available footprint.Trials and demonstrations can easily be carried out at our premisesusing customer’s products, so that you can see for yourself theadvantage of using microwave technology. 02_Layout 1 25/09/2017 13:19 Page 1ContentsOctober 2017This magazine is now fully recyclable. By recyclingmagazines, you can help reduce waste and add tothe 5.5 million tonnes of paper already recycledby the UK paper industry each year. Before yourecycle your magazine, please ensure you removeall plastic wrapping, free gifts and samples. FoodandDrinkInternational@fdiforumwww.fdiforum.netcompany/fdiforumNews 4• General news • On line - production news• On the shelf - new products and initiatives Import and export 12The food imports condition of the UK istenuous at best, with Brexit negotiations stillon edge. Many companies are now looking foropportunities further afield, but which marketsare ripe for expansion? Cold storage16 The working systems within a cold store facilitycan be just as integral to efficiency as the coldstore itself. 20th anniversary20This month, Food & Drink Internationalcelebrates its 20th anniversary, and we lookback over how we – and the industry as awhole – have changed.Labelling and traceability 24The horsemeat scandal highlightedvulnerabilities in the food supply chain and theneed for traceability both as means ofcounteracting these issues before they ariseand reassuring consumers. One of the lastingquestions from the 2013 controversy was howlong it would be before a similar scandal struckagain.Fruit and vegetables29Fruit and vegetables are big business, withmore than £1 billion worth exported from theUK last year alone. Like other corners of theworld, though, Britain is in the grips of a foodwaste epidemic, and at the centre of this crisisis the staggering amount of wasted fruit andvegetables.Control and automation32Automation is a long term solution to anumber of food and drink problems, so whyare more companies not taking advantage? Mixing and blending36The global blending and mixing market istipped for steady growth in the immediatefuture. Food and Drink International exploreswhat’s driving this growth.Group Editor: Steve Fisher (s.fisher@blmgroup.co.uk) Editor:Michael Fisher (m.fisher@blmgroup.co.uk) Editor’s PA: Angela Sharman (a.sharman@blmgroup.co.uk)Journalists: Stuart Pearcey (s.pearcey@blmgroup.co.uk)Dominic Cuthbert (d.cuthbert@blmgroup.co.uk)Sales Director: Teri Cooper (t.cooper@blmgroup.co.uk)Sales Manager: Sam Trott (s.trott@blmgroup.co.uk)Sales: Vicky Hunt (v.hunt@blmgroup.co.uk)Kimberley Read (k.read@blmgroup.co.uk)Tel: +44 (0) 1472 310302 Accounts & Subscriptions: John Downes (j.downes@blmgroup.co.uk)Design & Production: Gary Jorgensen, Mark Casson(studio@blmgroup.co.uk)Editorial:Tel: +44 (0) 1472 310305, Email:fdi@blmgroup.co.ukPart of the Business Link Magazine Group: Armstrong House, Armstrong Street,Grimsby, N E Lincs DN31 2QE EnglandAll rights reserved. No part of this publication may bereproduced, transmitted, photocopied, recorded orotherwise without express permission of the copyrightholder, for which application should be addressed first tothe publisher. While every reasonable care is taken, neitherthe publisher nor its participating agents accept liability forloss or damage to prints, colour transparencies, negatives orother material of whatever nature submitted to thispublication. The views expressed in this publication are notnecessarily the views of those held by the publisher.Environmental spotlight40As possibly the most expansive supply chain,the food industry accounts for a profoundsource of carbon emissions, something foodcompanies big and small are tackling head on.Lab Innovations43Lab Innovations returns from 1-2 November atthe NEC in Birmingham offering theopportunity to discover the latest innovationsin laboratory technology and analyticequipment.Gulfood Manufacturing44Gulfood Manufacturing is the largest and mostinfluential trade show for the food processingand manufacturing sector in the Middle East,North Africa and South Asia region.Food Matters Live48Food Matters Live, taking place at ExCeLLondon on November 21-23, is the only cross-sector event bringing together the food anddrink industry with retailers, foodserviceproviders, government and nutrition toenable collaboration, innovation and tosupport a sustainable future food landscape.Robotics & Automation49Robotics & Automation exhibition, the UK’sunmissable exhibition for robotics andautomation solutions, is taking place 11th & 12thOctober 2017 at Arena MK, Milton Keynes. Events50Your chance to keep abreast of forthcomingexhibitions and food fairs from around theworldClassified 53Food & DrinkDiary 54MAIN: SHUTTERSTOCK/DDSIGN • TOP: FRUTAROM• MIDDLE: SHUTTERSTOCK/WATTANACHON KONGTHON • BOTTOM: HENKEL03_Layout 1 25/09/2017 14:21 Page 1Queensland researchers smash avocadoproduction bottleneckResearchers from the University of Queensland inAustralia have developed a method of supplying500 times more avocado plants to industry.The new stem cell multiplication method coulddouble avocado production in Queensland.It could also reduce the time it takes for newvarieties to reach commercial orchards from 10years to three years or less.Professor Neena Mitter from the QueenslandAlliance for Agriculture and Food Innovation is leading the project.Queensland produces 50% of Australia’s high-value avocado crop – worth $460 million ayear. However, the industry is hampered by a shortage of high-quality planting material andthere is a backlog of plant orders until 2020.The technology is non-GM and environmentally-friendly, requiring less land, water, fertilisersand pesticides.“Ten-thousand plants can be generated in a 10 square-meter room on a soil-less media,” Professor Mitter said.“This is a potential game changer for the avocado industry across the globe.”news4 Food & Drink Internationalwww.fdiforum.netNew ink is ideal foroily applications Linx Printing Technologies has widened itsrange of specialist inks with the introduction ofa new formula that meets the challenges ofcoding onto oily surfaces. Linx Black oil-penetrating ink 1062 is able toprint effectively through light layers of oil ontoa wide range of materials, including plastics,metal, glass and waxy surfaces. It also providesgood adhesion on Oriented Polypropylene andother plastic films.Compatible with the full range of Linx 8900printers, Linx 1062 is an MEK-based ink with afast drying time of one to two seconds that isable to adhere to substances with an oily orgreasy film to deliver reliable long-term codedurability. It offers excellent contrast and legibility ontransparent and pale coloured materials, and isable to resist a range of oils includingengineering cutting fluid, petroleum andkerosene. Typical applications include canned foodsand packaging film for flow wrap, pouches andbags.Global industry IT specialist celebrates 40 yearsStarting out as a small team of consultantsfor the meat industry, Germany’s CSB-Systemhas developed into a globally active ITenterprise for the entire process industries offood, beverages, chemicals, pharmaceuticals,cosmetics and trade.Today the Group employs over 600 membersof staff, generates an annual sales volume of€77 million, and is one of the largest owner-managed software enterprises in Europe.With its offering of software, hardware,services and business consulting from a single source, the company sees itself as an innovationpartner that creates a competitive edge for its customer base. As from its inception, the central focus of the company remains the optimisation ofprocesses and products. “Our systems are not designed for all industries, but focused on a few to cater to theirspecific needs,” said company founder Dr Peter Schimitzek. “With our systematic optimisationapproach, we can guarantee Best Practices.” The company has now deployed CSB solutions at some 1,200 customers worldwide.Hollywood director opensmajor pea processing plantVerdient Foods, a companyformed by Oscar-winning filmdirector James Cameron andhis wife Suzy Amis, hasopened a pulse processingfacility in Vanscoy,Saskatchewan.Once fully operational, the160,000 metric-ton facility willbecome the largest organicpea protein fractionationfacility in North America.The Camerons have enteredinto a four-year researchcontract with the non-profitSaskatchewan Food IndustryDevelopment Centre and itspresident, Daniel Prefontaine,to develop value-addedorganic food products.These products will be produced by both Canadian and globalcompanies using ingredients from the Verdient Foods plant.YPS go green with sustainableshrink film Shrink wrapping specialistsYorkshire Packaging Systems hasunveiled its new, sustainable Bollore‘B-Nat’ shrink film to the packagingindustry.The award-winning Dewsbury-based firm, celebrating its 40thanniversary, is now offering thisunique, specialist film to meet thedemands of an increasinglyenvironmentally-conscious market.The groundbreaking film consists ofa polyethylene produced fromsugarcane ethanol. As well as sugarcane’s superior water efficiency, thefilm also captures more Co2 in its lifetime than its soybean and corncounterparts. Its cultivation does not occur on arable land, meaning itdoesn’t interfere or impact food production areas.Unlike other green alternatives, B-Nat shrink film does not incur anyefficiency penalty. It offers improved aesthetics and optics for enhancedshelf-attractiveness, with no compromise on cohesion strength for multi-packing applications. Whether on a manual or high-speed machine, thereis no disparity compared to more standard, less-green counterparts.The film is available in flat or centre-folded in multiple widths andvarying thicknesses. PHOTO: SHUTTERSTOCK/ FEATUREFLASH PHOTO AGENCY PHOTO: SHUTTERSTOCK/NATALIYA ARZAMASOVA 04-11_Layout 1 25/09/2017 14:29 Page 1ifm electronic –close to you!www.ifm.com/uk/magneticLong range alternative…when inductive sensors just don’t have the range you need, a magnetic sensor provides the answer. Easily reaching 60 or 70mm to a magnet, even an M12 magnetic sensor outperforms inductive. And of course a non-ferrous material is no barrier. No compromise: the all-stainless-steel housing and IP69K ratings will withstand the worst you can throw at them.04-11_Layout 1 25/09/2017 14:29 Page 2UNI Packaging’s vacuum pouchline increases UK manufacturingcapacityFlexiblepackaging group,UNI Packaging,has increasedmanufacturingcapacity and therange ofproductsproduced at itsUK site with theinstallation of avacuum pouch manufacturing line. Following an investment in a Titan SR9-DT Dual Turret Slitterinstalled last year, the addition of vacuum pouch manufacture is set toprovide their UK customers with increased flexibility and enhancedservice options, whilst allowing the firm to target new markets. With expanding capacity, the St Helens site is currently beingreorganised to create a more logical manufacturing workflow – adedicated print hall is being created, alongside a new lamination hallwith a new high tech film curing facility and a brand new slitting hall.UNI Packaging’s Simon Parisi said: “As an integrated group, we areable to identify and invest in new assets quickly and efficiently totarget and satisfy the needs of each country’s market conditions andgrowth opportunities.”news6 Food & Drink Internationalwww.fdiforum.netKingsmoor Packaging maintainsfood to go impetus for GreencoreLeadingthermoformingbusiness, KingsmoorPackaging, workedclosely with foodmanufacturerGreencore to deliverfour premiumquality food gradepackaging solutionsfor eleven of the‘grab & go’ lunch options.Produced for either salads or pasta recipes – such as Indian SpicedChicken Salad and Tomato & Basil Pasta – the thermoformed bowlshave either separate lids, or single web heat-sealed polyester liddingfilm and were manufactured in either black or clear rPET, whichcontains at least 50% post-consumer recycled waste. Kingsmoor Packaging’s James Hill said: “Our strength within theFMCG marketplace is being able to provide a fast and responsiveservice from design through to the manufacturing stage, and thenmaking sure everything is delivered on time for production trials andlaunch.“With in-house tooling and design, operating in tandem with ourstate of the art modern production facilities, we are able to provideGreencore with a nimble, flexible and cost effective single sourceservice.” 0$3$;0RGLILHG$WPRVSKHUH3DFNDJLQJ3UHVHUYHZKDWPDNHV\RXXQLTXH%2&ZLOOKHOS\RXVHOHFWWKHRSWLPDOPL[WXUHIRU\RXUIRRGSURGXFWLQRUGHUWRUHWDLQLWVRULJLQDOWDVWHWH[WXUHDQGDSSHDUDQFHDQGSURYLGHDWDLORUHGVHUYLFHWRVXLW\RXUSURFHVVVLWHDQGHPSOR\HHV:HGHOLYHUDUDQJHRI0$3$;VROXWLRQVGHGLFDWHGWRWKHQHHGVRIWKHIROORZLQJLQGXVWULHV߹%DNHU\DQGGULHGIRRGV߹'DLU\߹)LVKDQGVHDIRRG߹)UXLWVDQGYHJHWDEOHV߹0HDWDQGSRXOWU\߹3UHSDUHGDQGFDWHUHGIRRGV7RILQGRXWPRUHDERXWPRGLILHGDWPRVSKHUHSDFNDJLQJ0$3$;RUWKHIRRGJUDGHJDVHVDQGHTXLSPHQWRIIHUHGE\%2&FDOOXVRQHPDLOXVDWIRRG#ERFFRPRUYLVLWZZZ%2&IRRGFRXN%2&/LPLWHGUHJLVWHUHGRIÀFH7KH3ULHVWOH\&HQWUH3ULHVWOH\5RDG6XUUH\5HVHDUFK3DUN*XLOGIRUG*8;<(QJODQG1XPEHU²(QJOLVK5HJLVWHU$XWKRULVHGDQGUHJXODWHGE\WKH)LQDQFLDO&RQGXFW$XWKRULW\UHJLVWHUQXPEHU%2&LVDWUDGLQJQDPHXVHGE\FRPSDQLHVZLWKLQ7KH/LQGH*URXS7KH%2&ORJRDQGWKH%2&ZRUGDUHWUDGHPDUNVRI/LQGH$*0$3$;LVDQ(8UHJLVWHUHGWUDGHPDUNRI7KH/LQGH*URXS7UDGHPDUNUHJLVWUDWLRQVDQGWKHLUVWDWXVPD\GLIIHUIURPRQHORFDWLRQWRDQRWKHU&RS\ULJKW/LQGH$*04-11_Layout 1 25/09/2017 14:29 Page 3Herald enjoys spike in sales ofbespoke bakery items Quality disposablesmanufacturer and supplier,Herald has reported aspike in sales of bespokebakery products with anincreasing amount ofsmaller bakery chains andindependent bakersmoving on to branded andprinted packaging.The company, whichsells a full range ofcupcake, muffin and jellycases, as well as a wideselection of sandwich packaging, is looking forward to furtherexpanding its bakery product range in the coming 12 months as itcontinues with plans to extend both manufacturing and storagefacilities at its premises in Barking.Herald has already announced a 20% rise in sales across all of itsprinted catering products this year, reflecting what is a general trendin the demand for printed designs and more eye-catching packaging. Managing Director Yogesh Patel said: “The key to securing newbusiness for us will lie in our ability to hold larger amounts of stock,thanks to our increased warehouse space, and the variety of ourrange.”Food & Drink International 7www.fdiforum.netnewsInsect protein producer joinsinaugural IKEA start-upacceleratorIsraeli insect protein producer Flying SpArk has joined the inauguralIKEA Bootcamp start-up accelerator.The launch generated some 1,200 applications from 86 differentcountries. However, only 10 start-ups will join the IKEA productdevelopment centre in Älmhult, Sweden later this month.Flying SpArk is a new food-tech company focused on all-naturalprotein extracted from the Mediterranean fruit fly for humanconsumption.This ingredient is high in protein, calcium, iron and potassium. Unlikemeat, it is odourless and virtually cholesterol-free.The idea behind IKEA’s collaborative boot camp effort is what thecompany calls “Co-creating a better, everyday life”.The mission is to encourage start-ups that are working to solvesome of the world’s most pressing problems.The high demand for sustainable protein, combined with innovativetechnology, has driven strong support for Flying SpArk.The company has raised $1 million with the help of the IsraelInnovation Authority and The Kitchen, a food-tech incubatorsponsored by the Strauss Group.PHOTO: SHUTTERSTOCK/CATHERINL-PROD04-11_Layout 1 25/09/2017 14:29 Page 4Barry Callebaut unveils fourthkind of chocolateChocolatemanufacturer BarryCallebaut has revealed afourth type of chocolatesome 80 years after theintroduction of whitechocolate.Ruby chocolate – sonamed for its rose petalhue – will now sitalongside the ubiquitousdark, milk and white.This new categorypromises “intense sensorial delight”. It balances berry flavours with asmooth sensory profile.It is made from the ruby cocoa bean which, through a uniquemanufacturing process, Barry Callebaut unlocks the naturally occurringflavour and colour tone.No berry flavour or colours are added, making it unique amongconfectionery and chocolates currently available.The manufacturer said the process needed to unlock theseattributes too years to develop.According to quantitative research performed by independentinternational market and consumer agency Haystack, Ruby chocolatemeets a consumer need no chocolate ever did before.It’s expected that Ruby, like dark, milk and white chocolates, will beintroduced in different product categories.news8 Food & Drink Internationalwww.fdiforum.netNestlé takes major bite out ofBlue Bottle CoffeeNestlé hasacquired a majoritystake in theCalifornianspecialist coffeeroaster and retailerBlue Bottle Coffee.Blue BottleCoffee willcontinue to operateas a stand-aloneentity, while havingfull access toNestlé’s capabilities in coffee and its strong global consumer reach.The current management and employees will retain a minority stakeand continue to run the business with the same entrepreneurial spiritthat has made the brand so successful.Nestlé CEO Mark Schneider said: “This move underlines Nestlé’sfocus on investing in high-growth categories and acting on consumertrends.”Blue Bottle Coffee allows Nestlé to strengthen its position in the UScoffee market, the largest in the world, as well as internationally,building on success in Japan.It also offers opportunities to grow in super premium ready-to-drinkand roast and ground coffee, largely through online subscription.REGISTER FOR FREE TICKETSFARMBUSINESSSHOW.CO.UK 8 & 9 NOV 2017NEC, BIRMINGHAM1000’S OF IDEAS TO MAKE YOUR LAND MORE PROFITABLEINSPIRING RURAL ENTREPRENEURS7500exhibitorslive debates200seminarsALL NEWINNOVATIONSHOW CASEexpert advice from the claplanningpermissionexpertsmarketing & websiteexpertsPHOTO: SHUTTERSTOCK/ KIT LEONGPHOTO: BARRY CALLEBAUT04-11_Layout 1 25/09/2017 14:29 Page 5Food & Drink International 9www.fdiforum.neton the shelfWaitrose launch celeriac rice in UK firstWaitrose is believed to be the first UKsupermarket to introduce celeriac rice asthe trend for alternative carbs intensifies.The new product is made from rawceleriac which has been processed intorice-sized pieces.The retailer said the product holds itsstructure during cooking, making it anideal base for risottos or as anaccompaniment to curry.Waitrose vegetable buyer Tom Mooresaid: “We know our customers love analternative to traditional carbs,particularly when they’re made entirelyof fresh vegetables or are a tad unusual.”He added: “We hope fans of the vegetable will love this new way of enjoying celeriac, whichwould be tricky and time-consuming to do at home.”Frutarom releasevegan red for plant-based meat analoguesThe growing demand for vegan products hasinspired Frutarom to launch a clean-label, all-natural red colour range for plant-based meatanalogues.Today’s food manufacturers ofvegan/vegetarian meat analogues strive tomimic not only the flavour and texture, but alsothe colour of meat products.Frutarom’s Bright’n Free Red Rosy line of redcolours is plant-sourced, allergen-free and E-number free.It is specifically optimised forvegan/vegetarian meat analogue applications.It is highly heat-stable and so uniquelysuitable for items such as grilled, raw-cured, andpar-cooked vegetarian sausages and otherfoods undergoing a long cooking process.The line is derived from simple, naturalvegetable sources, allowing for transparentlabelling.It is kosher-certified, and available in a palm-free form. There is no selective extraction; theingredient is a simple concentration of squeezedplant juices rich in the natural antioxidantpigment anthocyanin.Packs at yourconvenience With continuing high demand forconvenience packaging solutions, RPC BeboUK has launched a selection of new packs inboth polypropylene (PP) and PET suitablefor a wide variety of products.The 60mm diameter PP pot – available in45ml, 60ml and 75ml sizes – is ideal for dips,salads, fruit pieces and snack meals. Thefour compartment Snap PP tray, with a220ml brimful capacity per cavity, offers aconvenient multi-pack solution for bothfood and non-food applications. Both packs can be specified in a choice of materials – monolayer PP or ultra-high clarityPPure, and barrier PP/EVOH/PP for long ambient shelf-life products. They are suitable fordirect food contact, hot filling and high temperature processes such as sterilisation andpasteurisation. Special grades are also available for microwave cooking and reheating.The Z101mm diameter straight sided PET container, in 198ml, 262ml, 294ml and 391ml sizes,has also been designed for many types of food applications, including chilled products. Pack allows a whole lotof shakingTwo RPC sites are collaborating in theproduction of a new shaker pack that allowsconsumers to produce the perfect cocktail inthe home.Funkin Cocktails supplies its all-naturalsyrups, fruit purees and cocktail mixes to someof the best bartenders. Produced for the retailmarket, the Cocktail Shaker range offers aquick and easy way to make great cocktails.Consumers use the cap as a measure to addthe relevant amount of spirits, along with someice, and then shake.Designed by Air Innovation, the shaker packis extrusion blow moulded in multilayerpolypropylene by RPC Promens ConsumerCorby and the lid and measuring cap injectionmoulded by RPC M&H Market Rasen. RPC Design worked on the technical aspectsof the pack, including the provision of strengthening rings andhoops, to ensure the finished bottle could withstand the rigours ofboth hot and cold filling, depending on the requirements of thedifferent mixtures. Hobgoblin taps into Ardagh kegtechnologyHobgoblin, one of the UK’sleading and mostrecognisable beer brands, isnow available in a 5 litreArdagh Group beer keg forboth its Ruby and Goldversions to take advantage ofgrowth in the off trade forthe mini keg format.The brand’s owner,Marston’s, chose the Ardaghkeg because of a new servingsystem developed by Ardaghto provide a smoother ‘pulland tap’ action. Thisinnovation provides drinkers with the same experience of a pint beingpoured in the pub as they consume their favourite beer at home.Other important features of the keg are a new venting system, anairtight resealable plug that increases shelf life by several days once thekeg is opened, and a large surface area that takes full advantage of theproduct’s highly distinctive branding, which is reproduced at Ardagh’sspecialist keg manufacturing plant in Germany.PHOTO: WAITROSE 04-11_Layout 1 25/09/2017 14:29 Page 6Next >