TRACEABILITYBEVEXPOINTERNATIONALFood&DrinkFood&Drinkwww.fdiforum.netDECEMBER 2017£3.50 STERLINGNEWSSweetsuccessSweetsuccess01_Layout 1 22/11/2017 09:30 Page 1Season’s Greeting and a Happy New YearWelbilt (Halesowen) LtdChancel Way, HalesowenWest Midlands, B62 8SE, UKTel: +44.121.501.2566Email: multiplex.uk@welbilt.comWeb: www.welbilt.comMultiplex puts you ahead of the curve because we put ourselves at the forefront of change. We are inspired not by what we have done, but rather by what is next for beverage experiences.With our end-to-end, and holistic expertise, we are in a unique position to forecast the future, so you’re not left in the past. We know that the success of your beverage program is shaped by more At Multiplex, we work together with our customers, to discover better ways to build real solutions that create Thirsty to know more?02_Layout 1 21/11/2017 15:41 Page 1ContentsDecember 2017This magazine is now fully recyclable. By recyclingmagazines, you can help reduce waste and add tothe 5.5 million tonnes of paper already recycledby the UK paper industry each year. Before yourecycle your magazine, please ensure you removeall plastic wrapping, free gifts and samples. FoodandDrinkInternational@fdiforumwww.fdiforum.netcompany/fdiforumNews 4• General news • On line - production news• On the shelf - new products and initiatives • AppointmentsImport and export14 After being hailed the world’s largest exporterof red meat, it’s evident that there’s more toAustralia’s food industry than “shrimp on theBarbie”.Warehousing optimisation18A better connected, more efficient warehouseis becoming reality through the use ofautomated systems and a growing reliance onartificial intelligence. These solutions aredependent on advanced software, meaningthe key to a more streamlined space is throughapplied information. • LogistexProcess, control andautomation 22Looking ahead into 2018, efficiency is sure tobe a bigger concern than ever within the foodand drink industry. Despite this, UK companiesare still behind the curve when it comes tocontrol and automation – and that cannot beallowed to continue. Traceability27Traceability in the food supply chain is evolvingwith the advent of blockchain technology. • Matrox ImagingEnd of year successes32Despite the year being hailed as one of theworst on the political, environmental or socialscene, the food and drink industry hasremained as strong as ever, with numeroussuccess stories across the sector.End of line packaging35End of line packaging is integral fortransportation, display and safety – but how isthe market developing?Group Editor: Steve Fisher (s.fisher@blmgroup.co.uk) Editor:Michael Fisher (m.fisher@blmgroup.co.uk) Editor’s PA: Angela Sharman (a.sharman@blmgroup.co.uk)Journalists: Stuart Pearcey (s.pearcey@blmgroup.co.uk)Dominic Cuthbert (d.cuthbert@blmgroup.co.uk)Sales Director: Teri Cooper (t.cooper@blmgroup.co.uk)Sales Manager: Sam Trott (s.trott@blmgroup.co.uk)Sales: Vicky Hunt (v.hunt@blmgroup.co.uk)Kimberley Read (k.read@blmgroup.co.uk)Tel: +44 (0) 1472 310302 Accounts & Subscriptions: John Downes (j.downes@blmgroup.co.uk)Design & Production: Gary Jorgensen, Mark Casson(studio@blmgroup.co.uk)Editorial:Tel: +44 (0) 1472 310305, Email:fdi@blmgroup.co.ukPart of the Business Link Magazine Group: Armstrong House, Armstrong Street,Grimsby, N E Lincs DN31 2QE EnglandAll rights reserved. No part of this publication may bereproduced, transmitted, photocopied, recorded orotherwise without express permission of the copyrightholder, for which application should be addressed first tothe publisher. While every reasonable care is taken, neitherthe publisher nor its participating agents accept liability forloss or damage to prints, colour transparencies, negatives orother material of whatever nature submitted to thispublication. The views expressed in this publication are notnecessarily the views of those held by the publisher.Recycling and wastemanagement40Food waste is one the latest industrybugbears, but donating surplus food to socialenterprises and diverting waste to anaerobicdigesters is helping theUK to achieve its goal of zero food waste tolandfill by 2020.ProSweets Cologne43Taking place at Koelnmesse in Germany from29 January to 1 February 2018, ProSweetsCologne is the international supplier fair forthe sweets and snacks industry. BevExpo44Returning to The Ricoh Arena in Coventryfrom 34-24 January 2018, BevExpo is a free-to-attend, two-day event showcasing theentire beverage supply chain.Events46Your chance to keep abreast of forthcomingexhibitions and food fairs from around theworldClassified 49Food & Drink Diary 50MAIN: SHUTTERSTOCK/RUSIAN SEMICHEV • TOP: BEVEXPO• MIDDLE: SHUTTERSTOCK/GOODLUZ • BOTTOM: SHUTTERSTOCK/MONTICELLO03_Layout 1 22/11/2017 09:24 Page 1Mars Food completesPreferred BrandsacquisitionMars Food has completed its acquisition of PreferredBrands International, the manufacturer of ready-to-heatIndian and Asian food sold under the Tasty Bite brand.Originally announced in August, the deal sees Marstake charge of Tasty Bite’s portfolio, which includesIndian/Asian entrees, spice and simmer meal kits, andorganic rice and lentils.Fiona Dawson, Global President, Mars Food, Drinks andMultisales, said: “I’m delighted that we have completed theacquisition of Preferred Brands International and Tasty Bite.From our first meeting with the company we were impressed by the strength of their portfolio, capabilities and thestrong values which run through the business, allowing us to deliver against our Purpose: Better Food Today. A Better World Tomorrow.”news4 Food & Drink Internationalwww.fdiforum.netBrewDog keeps punkspirit alive withpolitically charged beerWith the launch of its latest protest beer,‘Make Earth Great Again’, BrewDog hopes it will“shake the world by the shoulders” and remindworld leaders to prioritise climate changeissues. The craft brewer was first compelled to brewthe beer after the US pulled out of the ParisAccord. The new beer is to be served directlyfrom a beer tap built into a life-size polar bearreplica and contains ingredients sourced fromareas most affected by global warming.All proceeds will be donated to 10:10, acharity lobbying for legislative changes totackle climate change.BrewDog has also sent a case of Make EarthGreat Again bottles to The White House, in anattempt to capture the attention of thePresident.Ishida RobotGrader and Airscan win at debutindustry awardsIshida Europe’s innovativeRobotGrader has been named winner ofthe ‘Robotics Industrial Vision’ categoryat the inaugural Gulfood ManufacturingIndustry Excellence Awards in Dubai. The RobotGrader combines weighingand pick and place technologies to gradeprotein products of varying weight andpack them to a fixed weight straight intoa tray. The system reduces giveaway toless than 1% per pack and correctlyplaces and orientate the pieces, at speeds of up to 320 pieces per minute. By comparison, a manual operation can be a very labour intensive with a single operator onlyable to pack 30 pieces/min, while overfill can be anywhere from 5% to up to 10%.It can be incorporated into Ishida fresh food packing lines alongside other Ishida equipment,including X-ray systems, tray sealers, seal testers and checkweighers, to provide bespokesolutions, tailored to individual customer requirements. Ishida was also able to secure a ‘Highly Commended Award’ for their revolutionary leakdetector, Ishida Airscan. Multitank is the ideal space savingsolution to reduce your carbonfootprintGoplasticpallets.com hasintroduced the new Multitank 400litre IBC, which has been designedto improve the packaging, storingand transporting of food and non-food products in bulk, in asustainable way.What’s more, its unique conicaldesign and robust constructionmeans it’s a cost effective reusablepackaging system that can save astaggering 75% of storage spacethanks to its stacking and nesting abilities.“It is an extremely versatile IBC plastic container, for use in food, foodingredients processes and transportation,” said Goplasticpallets.comManaging Director Jim Hardisty. “In reality, however, it is unlimited in its application – the possibilities areendless covering food waste, retail waste, recycling, and many more bulkapplications.”The Multitank comes with a main lid and a secondary, smaller,removable lid and an innovative way of sealing which assure maximumsafety and offers an excellent watertight and airtight performance.Campbell Soup Company joinsPlant Based Foods AssociationCampbell Soup Company is the firstmajor food company to join the PlantBased Foods Association – the onlytrade group in the US representing theplant-based foods sector.Launched in March 2016, the PlantBased Foods Association (PBFA)represents more than 80 US companiesand advocates on behalf of itsmembers and works to expand marketsin the retail and foodservice sectors.Campbell has stayed abreast of theindustry zeitgeist and assimilated theplant-based movement, rather thanshunning it.The company has bolstered theamount of vegetables and whole grainsin its portfolio and has accelerated efforts to bring more packagedfresh and refrigerated products to the retail perimeter.Recently, it launched a new line of plant-based milks under itsBolthouse Farms brand.“Working together with the Plant Based Foods Association, wecan advance our shared goal of bringing more plant-based foods toconsumers,” Ed Carolan, President, Campbell Fresh.SHUTTERSTOCK/MIKELEDRAYBREWDOG04-13_Layout 1 21/11/2017 15:51 Page 1Smart sensing in 3DBuilt-in apps make 3D sensor easy to use ! "# " $% &www.ifm.com/uk/o3difm Telephone (020) 8213 1111yearsWARRANTYon ifm rots04-13_Layout 1 21/11/2017 15:51 Page 2news6 Food & Drink Internationalwww.fdiforum.netHilton completes £84m Seachill acquisitionHilton Food Group has completed its£84 million acquisition of IcelandicGroup’s Grimsby-based subsidiary,Seachill.The deal, originally announced inOctober, sees the meat packing businesstake charge of the seafood specialistwhich also includes The Saucy Fish Cobrand.Announced back in April, the Seachillsale process attracted a frenzy ofinternational interest, though it was Hiltonthat finally reeled in the company.Seachill will now become a standalone division of Hilton with the existing management teamremaining in place.Current Seachill CEO Simon Smith will continue to lead the business as a divisional head ofHilton.Cargill expandsNashville facility ascompany targetsprotein growthCargill’s North America protein business isinvesting $146 million to expand the company’sNashville facility to keep up with the growinghunger for protein.The company said that the investment willgrow its meat crumble offerings for foodingredient, foodservice and retail customers.It will include construction of a state-of-the-art dried sausage production facility and willcreate more than 100 jobs, doubling thefacility’s current employment.This latest effort is part of Cargill’s widerefforts to grow its protein business. Over thepast two years, the company has investednearly $850 million in US protein expansion.The Nashville facility complements thecompany’s cooked meats facilities in Nebraska,Virginia, Texas and Minnesota.Sausage production is scheduled to begin atNashville during the first half of 2019.BRC Accreditation for WERIT’sindustrial packaging production plantWERIT UK, a leading UKmanufacturer of Intermediate BulkContainers (IBCs), canisters, containersand pallets, has recently announcedthe award of British Retail Consortium(BRC) accreditation at its factory inIrlam, Manchester. Qualification for this accreditationsaw WERIT UK embark on an 18month journey which included a fullreview of operational, quality andadministrative processes to ensureconformity with the BRC standard. For WERIT UK, the desire to achieveBRC accreditation was driven bycustomers seeking to ensure that thestandards already in existence wereverified by a recognised external standard specific to the Food Industry.Essentially the quality, safety and legal standards maintained within WERITUK’s manufacturing facility are proven to be directly equivalent andcompatible with those of the food production facilities of its own customers. To complement its recent BRC Accreditation, WERIT have also launchedthe NUTRIline IBC which is expected to be a popular choice amongstcustomers in the food industry. Hormel enhances deli meatsposition with acquisitionHormelFoods hasacquiredColumbusManufacturingfor $850 million,a catalyst, itclaims, forenhancing itsposition in thepremium,authentic delimeats market.“The acquisition of Columbus will serve as a catalyst foruniting all our deli businesses into one customer-facingorganization,” said Hormel President and CEO Jim Snee.“This acquisition significantly enhances our scale in the deli bybroadening our portfolio of products, customers, andconsumers.”“As a millennial-focused brand, Columbus has generatedcategory-leading growth through a passionate commitment toquality, simplicity, and time-honoured recipes,” added JoeEnnen, Columbus CEO.SHUTTERSTOCK/BW FOLSOMSHUTTERSTOCK/NOTARYESSHUTTERSTOCK/MONTICELLOAward hat-trick for YPSThe PPMA Group Industry Awards are a highlight ofthe prestigious industry event and this year YorkshirePackaging Systems’ apprentice Jake Martin fought offstiff competition and scooped the ‘Apprentice of theYear’ accolade. This wraps up a hat-trick for the company after theywon the ‘PPMA Outstanding Achievement’ award and‘PPMA Customer Service’ award in previous years. Winning this well-deserved award is a huge accoladefor Jake who is about to complete his four yearapprenticeship period at the end of 2017 to become afully–fledged service engineer. He has showncommitment, dedication, initiative, creativity, brilliantproduct knowledge and competence throughout thistime, making him truly a worthy winner. Glyn Johnson, YPS Managing Director, said: “We areso proud of Jake and how far he was come during hisapprenticeship programme with us. His dedication, hard work, team spirit and his outstandingtalent have been justly rewarded with this award.”04-13_Layout 1 21/11/2017 15:51 Page 3TUBE-IN-TUBE TECHNOLOGYExtra Cold & Consistent Beer at every PourNo Need for a Secondary Cooling UnitReduced Microbiological Growth in BeerlineTRUSTED BY THE BESTConnect with us at BevExpo Stand No. 55 - 56Find out more at johnguest.com04-13_Layout 1 21/11/2017 15:51 Page 4Liquid dairy makers can breakinto ice creammarket with newpackageTetra Pak has offered a way for foodmakers to produce dairy and juice drinksusing existing processes and then marketthem as ice creams and frozen desserts.Its new package, Tetra Fino Aseptic 100Ultra MiM, allows dairy and juice drinks tobe produced and distributed in smallcarton pouches at room temperature, andsubsequently turned into frozen productsin shops or in a consumer’s home.This means producers can tap into the$72 billion global ice cream marketwithout the need for additionalinvestment in production equipment andchilled distribution system.China’s Want Want is the first companyto trial this product.The new package will be available from2018 in the Greater Middle East, Europeand Asia.newsMeal deals in firing line as highsugar content revealedSupermarketmeal deals are thelatest in the firingline in the battleagainst sugarafter it wasrevealed thatsome contain asmuch as 30teaspoons ofsugar.A survey fromAction on Sugarfound that certainfood and drinkcombinations peddled by supermarkets contain four times an adult’sdaily maximum intake in a single lunch.Now the health expert group has called on supermarkets andretailers to take responsibility for their meals deals.It proposes sellers removed high sugar drinks and confectionarysold as part of their meal deals.Retailers are also being advised to consider upping their offering ofhealthier choices in meal deals in place of high sugar, salt and startedfat fare.Graham MacGregor, Chairman of Action on Sugar, said: “Thegovernment now needs to take decisive action to ban all promotionsof unhealthy foods.”8 Food & Drink Internationalwww.fdiforum.netTo advertise yourservices in Food & DrinkInternational contact us on01472 310302SHUTTERSTOCK/SPEEDKINGZPHOTO: TETRA PAK04-13_Layout 1 21/11/2017 15:51 Page 5Food & Drink International 9www.fdiforum.netInternrnationalsupplierffaair for theppbeveragage industryCOLOGNE, 20.–23.03.2018www.anugafoodtec.comFood Processing | Food Packaging | Safety & AnalyticsFood Ingredients | Services & Solutions ONE FOR ALL.ALL IN ONE.Koelnmesse GmbHMesseplatz 150679 Köln, GermanyTel. +49 1806 578 866Fax +49 221 821-991020anugafoodtec@visitor.koelnmesse.desfood andAFT_2018_Anzeige_Food_Drink_Intl_190x135mm_Int_GB.indd 109.10.17 16:360$3$;0RGLILHG$WPRVSKHUH3DFNDJLQJ3UHVHUYHZKDWPDNHV\RXXQLTXH%2&ZLOOKHOS\RXVHOHFWWKHRSWLPDOPL[WXUHIRU\RXUIRRGSURGXFWLQRUGHUWRUHWDLQLWVRULJLQDOWDVWHWH[WXUHDQGDSSHDUDQFHDQGSURYLGHDWDLORUHGVHUYLFHWRVXLW\RXUSURFHVVVLWHDQGHPSOR\HHV:HGHOLYHUDUDQJHRI0$3$;VROXWLRQVGHGLFDWHGWRWKHQHHGVRIWKHIROORZLQJLQGXVWULHV߹%DNHU\DQGGULHGIRRGV߹'DLU\߹)LVKDQGVHDIRRG߹)UXLWVDQGYHJHWDEOHV߹0HDWDQGSRXOWU\߹3UHSDUHGDQGFDWHUHGIRRGV7RILQGRXWPRUHDERXWPRGLILHGDWPRVSKHUHSDFNDJLQJ0$3$;RUWKHIRRGJUDGHJDVHVDQGHTXLSPHQWRIIHUHGE\%2&FDOOXVRQHPDLOXVDWIRRG#ERFFRPRUYLVLWZZZ%2&IRRGFRXN%2&/LPLWHGUHJLVWHUHGRIÀFH7KH3ULHVWOH\&HQWUH3ULHVWOH\5RDG6XUUH\5HVHDUFK3DUN*XLOGIRUG*8;<(QJODQG1XPEHU²(QJOLVK5HJLVWHU$XWKRULVHGDQGUHJXODWHGE\WKH)LQDQFLDO&RQGXFW$XWKRULW\UHJLVWHUQXPEHU%2&LVDWUDGLQJQDPHXVHGE\FRPSDQLHVZLWKLQ7KH/LQGH*URXS7KH%2&ORJRDQGWKH%2&ZRUGDUHWUDGHPDUNVRI/LQGH$*0$3$;LVDQ(8UHJLVWHUHGWUDGHPDUNRI7KH/LQGH*URXS7UDGHPDUNUHJLVWUDWLRQVDQGWKHLUVWDWXVPD\GLIIHUIURPRQHORFDWLRQWRDQRWKHU&RS\ULJKW/LQGH$*04-13_Layout 1 21/11/2017 15:51 Page 6Next >